PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT13476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family BES1
Protein Properties Length: 313aa    MW: 33484.4 Da    PI: 7.9062
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT13476genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.93.4e-65171582144
    DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslq.sslks 100
               g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlk LcreAGwvvedDGttyrkg+kp+ + +  ++ssa +sp+ss+q +s+ s
  EMT13476  17 GLGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKELCREAGWVVEDDGTTYRKGYKPPsSGPFGGVSSAGMSPCSSSQlLSAPS 117
               679************************************************************************444455556677********9***** PP

    DUF822 101 salaspvesysaspksssfpspssldsislasaasllpvlsvls 144
               s+++spv+sy+asp+sssfpsps+ld+ s   +a+llp+l+ l+
  EMT13476 118 SSFPSPVPSYHASPASSSFPSPSRLDNSS---PACLLPFLRGLP 158
               *************************9874...468888877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.3E-6118145IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTSGAARAAA AAEADAGLGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYKLPKHC  60
DNNEVLKELC REAGWVVEDD GTTYRKGYKP PSSGPFGGVS SAGMSPCSSS QLLSAPSSSF  120
PSPVPSYHAS PASSSFPSPS RLDNSSPACL LPFLRGLPNL PPLRVSNSAP VTPPLSSPTA  180
SRPPKILKPD WEVDPFRHPF FALSAPASPP RGRRHEHPDT IPECDESDVS TVDSGRWISF  240
QMATTAPTSP AYNLVNLGAS SSNSMEMDGM AGERGRSGPE FEFDKGGGTP WEGERIHEVA  300
AEELELTLGV GSK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4007390.0JN400739.1 Triticum aestivum cultivar Chinese Spring BES1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645123.11e-147PREDICTED: protein BZR1 homolog 1
SwissprotB8B7S51e-149BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI961e-149BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLN1R2I90.0N1R2I9_AEGTA; Uncharacterized protein
STRINGBGIOSGA024018-PA1e-146(Oryza sativa Indica Group)
STRINGLOC_Os07g39220.11e-146(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.36e-36BES1 family protein